CNTF polyclonal antibody
  • CNTF polyclonal antibody

CNTF polyclonal antibody

Ref: AB-PAB31678
CNTF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CNTF.
Información adicional
Size 100 uL
Gene Name CNTF
Gene Alias HCNTF
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 105-198 of human CNTF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1270
Iso type IgG

Enviar uma mensagem


CNTF polyclonal antibody

CNTF polyclonal antibody