LCP1 polyclonal antibody
  • LCP1 polyclonal antibody

LCP1 polyclonal antibody

Ref: AB-PAB31675
LCP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LCP1.
Información adicional
Size 100 uL
Gene Name LCP1
Gene Alias CP64|DKFZp781A23186|FLJ25423|FLJ26114|FLJ39956|L-PLASTIN|LC64P|LPL|PLS2
Gene Description lymphocyte cytosolic protein 1 (L-plastin)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 18-77 of human LCP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3936
Iso type IgG

Enviar uma mensagem


LCP1 polyclonal antibody

LCP1 polyclonal antibody