ARL6 polyclonal antibody
  • ARL6 polyclonal antibody

ARL6 polyclonal antibody

Ref: AB-PAB31626
ARL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARL6.
Información adicional
Size 100 uL
Gene Name ARL6
Gene Alias BBS3|MGC32934
Gene Description ADP-ribosylation factor-like 6
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 92-184 of human ARL6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84100
Iso type IgG

Enviar uma mensagem


ARL6 polyclonal antibody

ARL6 polyclonal antibody