QKI polyclonal antibody
  • QKI polyclonal antibody

QKI polyclonal antibody

Ref: AB-PAB31618
QKI polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human QKI.
Información adicional
Size 100 uL
Gene Name QKI
Gene Alias DKFZp586I0923|Hqk|QK|QK1|QK3
Gene Description quaking homolog, KH domain RNA binding (mouse)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P,IF
Immunogen Prot. Seq RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 163-311 of human QKI.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9444
Iso type IgG

Enviar uma mensagem


QKI polyclonal antibody

QKI polyclonal antibody