SERPINB5 polyclonal antibody
  • SERPINB5 polyclonal antibody

SERPINB5 polyclonal antibody

Ref: AB-PAB31614
SERPINB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SERPINB5.
Información adicional
Size 100 uL
Gene Name SERPINB5
Gene Alias PI5|maspin
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 5
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1-95 of human SERPINB5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5268
Iso type IgG

Enviar uma mensagem


SERPINB5 polyclonal antibody

SERPINB5 polyclonal antibody