FNTA polyclonal antibody
  • FNTA polyclonal antibody

FNTA polyclonal antibody

Ref: AB-PAB31607
FNTA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FNTA.
Información adicional
Size 100 uL
Gene Name FNTA
Gene Alias FPTA|MGC99680|PGGT1A|PTAR2
Gene Description farnesyltransferase, CAAX box, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FNTA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2339
Iso type IgG

Enviar uma mensagem


FNTA polyclonal antibody

FNTA polyclonal antibody