RNPEP polyclonal antibody
  • RNPEP polyclonal antibody

RNPEP polyclonal antibody

Ref: AB-PAB31575
RNPEP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RNPEP.
Información adicional
Size 100 uL
Gene Name RNPEP
Gene Alias DKFZp547H084
Gene Description arginyl aminopeptidase (aminopeptidase B)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QALCVSFPQPCRAAERLQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RNPEP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6051
Iso type IgG

Enviar uma mensagem


RNPEP polyclonal antibody

RNPEP polyclonal antibody