CETN3 polyclonal antibody
  • CETN3 polyclonal antibody

CETN3 polyclonal antibody

Ref: AB-PAB31573
CETN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CETN3.
Información adicional
Size 100 uL
Gene Name CETN3
Gene Alias CEN3|MGC12502|MGC138245
Gene Description centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CETN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1070
Iso type IgG

Enviar uma mensagem


CETN3 polyclonal antibody

CETN3 polyclonal antibody