FATE1 polyclonal antibody
  • FATE1 polyclonal antibody

FATE1 polyclonal antibody

Ref: AB-PAB31569
FATE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FATE1.
Información adicional
Size 100 uL
Gene Name FATE1
Gene Alias FATE
Gene Description fetal and adult testis expressed 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FATE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 89885
Iso type IgG

Enviar uma mensagem


FATE1 polyclonal antibody

FATE1 polyclonal antibody