ALS2CR8 polyclonal antibody
  • ALS2CR8 polyclonal antibody

ALS2CR8 polyclonal antibody

Ref: AB-PAB31568
ALS2CR8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ALS2CR8.
Información adicional
Size 100 uL
Gene Name ALS2CR8
Gene Alias CARF|DKFZp667N246|FLJ12675|FLJ21579|NYD-SP24
Gene Description amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVYNSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ALS2CR8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 79800
Iso type IgG

Enviar uma mensagem


ALS2CR8 polyclonal antibody

ALS2CR8 polyclonal antibody