MNDA polyclonal antibody
  • MNDA polyclonal antibody

MNDA polyclonal antibody

Ref: AB-PAB31567
MNDA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MNDA.
Información adicional
Size 100 uL
Gene Name MNDA
Gene Alias PYHIN3
Gene Description myeloid cell nuclear differentiation antigen
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQTSSSTPSNTSFTPNQETQAQRQVDARRNVPQNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEIKEASSVSDFN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MNDA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4332
Iso type IgG

Enviar uma mensagem


MNDA polyclonal antibody

MNDA polyclonal antibody