AIM2 polyclonal antibody
  • AIM2 polyclonal antibody

AIM2 polyclonal antibody

Ref: AB-PAB31565
AIM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human AIM2.
Información adicional
Size 100 uL
Gene Name AIM2
Gene Alias PYHIN4
Gene Description absent in melanoma 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human AIM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9447
Iso type IgG

Enviar uma mensagem


AIM2 polyclonal antibody

AIM2 polyclonal antibody