TAGAP polyclonal antibody
  • TAGAP polyclonal antibody

TAGAP polyclonal antibody

Ref: AB-PAB31564
TAGAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TAGAP.
Información adicional
Size 100 uL
Gene Name TAGAP
Gene Alias FKSG15|FLJ32631|FLJ39771|MGC133247|MGC27381|TAGAP1
Gene Description T-cell activation RhoGTPase activating protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SLEHTDSSDVSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TAGAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 117289
Iso type IgG

Enviar uma mensagem


TAGAP polyclonal antibody

TAGAP polyclonal antibody