TEAD3 polyclonal antibody
  • TEAD3 polyclonal antibody

TEAD3 polyclonal antibody

Ref: AB-PAB31557
TEAD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TEAD3.
Información adicional
Size 100 uL
Gene Name TEAD3
Gene Alias DTEF-1|ETFR-1|TEAD5|TEF-5|TEF5
Gene Description TEA domain family member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TEAD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7005
Iso type IgG

Enviar uma mensagem


TEAD3 polyclonal antibody

TEAD3 polyclonal antibody