PAGE4 polyclonal antibody
  • PAGE4 polyclonal antibody

PAGE4 polyclonal antibody

Ref: AB-PAB31542
PAGE4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PAGE4.
Información adicional
Size 100 uL
Gene Name PAGE4
Gene Alias FLJ35184|GAGE-9|GAGEC1|JM-27|JM27|PAGE-1|PAGE-4
Gene Description P antigen family, member 4 (prostate associated)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PAGE4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9506
Iso type IgG

Enviar uma mensagem


PAGE4 polyclonal antibody

PAGE4 polyclonal antibody