B9D1 polyclonal antibody
  • B9D1 polyclonal antibody

B9D1 polyclonal antibody

Ref: AB-PAB31541
B9D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human B9D1.
Información adicional
Size 100 uL
Gene Name B9D1
Gene Alias B9|EPPB9
Gene Description B9 protein domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human B9D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27077
Iso type IgG

Enviar uma mensagem


B9D1 polyclonal antibody

B9D1 polyclonal antibody