KIFC3 polyclonal antibody
  • KIFC3 polyclonal antibody

KIFC3 polyclonal antibody

Ref: AB-PAB31537
KIFC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KIFC3.
Información adicional
Size 100 uL
Gene Name KIFC3
Gene Alias DKFZp686D23201|FLJ34694
Gene Description kinesin family member C3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KIFC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3801
Iso type IgG

Enviar uma mensagem


KIFC3 polyclonal antibody

KIFC3 polyclonal antibody