C9orf103 polyclonal antibody
  • C9orf103 polyclonal antibody

C9orf103 polyclonal antibody

Ref: AB-PAB31536
C9orf103 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human C9orf103.
Información adicional
Size 100 uL
Gene Name C9orf103
Gene Alias bA522I20.2
Gene Description chromosome 9 open reading frame 103
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human C9orf103.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 414328
Iso type IgG

Enviar uma mensagem


C9orf103 polyclonal antibody

C9orf103 polyclonal antibody