PAEP polyclonal antibody
  • PAEP polyclonal antibody

PAEP polyclonal antibody

Ref: AB-PAB31534
PAEP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PAEP.
Información adicional
Size 100 uL
Gene Name PAEP
Gene Alias GD|GdA|GdF|GdS|MGC138509|MGC142288|PAEG|PEP|PP14
Gene Description progestagen-associated endometrial protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQME
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PAEP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5047
Iso type IgG

Enviar uma mensagem


PAEP polyclonal antibody

PAEP polyclonal antibody