KRT75 polyclonal antibody
  • KRT75 polyclonal antibody

KRT75 polyclonal antibody

Ref: AB-PAB31530
KRT75 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KRT75.
Información adicional
Size 100 uL
Gene Name KRT75
Gene Alias K6HF|KB18|PFB
Gene Description keratin 75
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KRT75.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9119
Iso type IgG

Enviar uma mensagem


KRT75 polyclonal antibody

KRT75 polyclonal antibody