CDR2 polyclonal antibody
  • CDR2 polyclonal antibody

CDR2 polyclonal antibody

Ref: AB-PAB31524
CDR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDR2.
Información adicional
Size 100 uL
Gene Name CDR2
Gene Alias CDR62|Yo
Gene Description cerebellar degeneration-related protein 2, 62kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1039
Iso type IgG

Enviar uma mensagem


CDR2 polyclonal antibody

CDR2 polyclonal antibody