FGD5 polyclonal antibody
  • FGD5 polyclonal antibody

FGD5 polyclonal antibody

Ref: AB-PAB31518
FGD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FGD5.
Información adicional
Size 100 uL
Gene Name FGD5
Gene Alias ZFYVE23
Gene Description FYVE, RhoGEF and PH domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FGD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 152273
Iso type IgG

Enviar uma mensagem


FGD5 polyclonal antibody

FGD5 polyclonal antibody