PCP4 polyclonal antibody
  • PCP4 polyclonal antibody

PCP4 polyclonal antibody

Ref: AB-PAB31506
PCP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PCP4.
Información adicional
Size 100 uL
Gene Name PCP4
Gene Alias PEP-19
Gene Description Purkinje cell protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PCP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5121
Iso type IgG

Enviar uma mensagem


PCP4 polyclonal antibody

PCP4 polyclonal antibody