PTGES polyclonal antibody
  • PTGES polyclonal antibody

PTGES polyclonal antibody

Ref: AB-PAB31502
PTGES polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTGES.
Información adicional
Size 100 uL
Gene Name PTGES
Gene Alias MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene Description prostaglandin E synthase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTGES.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9536
Iso type IgG

Enviar uma mensagem


PTGES polyclonal antibody

PTGES polyclonal antibody