HEATR7A polyclonal antibody
  • HEATR7A polyclonal antibody

HEATR7A polyclonal antibody

Ref: AB-PAB31499
HEATR7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HEATR7A.
Información adicional
Size 100 uL
Gene Name HEATR7A
Gene Alias DKFZp434I0113|DKFZp434P167|FLJ13324|FLJ35542|FLJ36244|FLJ36266|FLJ42560|KIAA1833|MGC50841
Gene Description HEAT repeat containing 7A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HEATR7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 727957
Iso type IgG

Enviar uma mensagem


HEATR7A polyclonal antibody

HEATR7A polyclonal antibody