CAMKK2 polyclonal antibody
  • CAMKK2 polyclonal antibody

CAMKK2 polyclonal antibody

Ref: AB-PAB31486
CAMKK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CAMKK2.
Información adicional
Size 100 uL
Gene Name CAMKK2
Gene Alias CAMKK|CAMKKB|KIAA0787|MGC15254
Gene Description calcium/calmodulin-dependent protein kinase kinase 2, beta
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 2-137 of human CAMKK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10645
Iso type IgG

Enviar uma mensagem


CAMKK2 polyclonal antibody

CAMKK2 polyclonal antibody