PPM1B polyclonal antibody
  • PPM1B polyclonal antibody

PPM1B polyclonal antibody

Ref: AB-PAB31485
PPM1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PPM1B.
Información adicional
Size 100 uL
Gene Name PPM1B
Gene Alias MGC21657|PP2C-beta-X|PP2CB|PP2CBETA|PPC2BETAX
Gene Description protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 359-463 of human PPM1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5495
Iso type IgG

Enviar uma mensagem


PPM1B polyclonal antibody

PPM1B polyclonal antibody