CBX5 polyclonal antibody
  • CBX5 polyclonal antibody

CBX5 polyclonal antibody

Ref: AB-PAB31484
CBX5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CBX5.
Información adicional
Size 100 uL
Gene Name CBX5
Gene Alias HP1|HP1A
Gene Description chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLM
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 30-137 of human CBX5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23468
Iso type IgG

Enviar uma mensagem


CBX5 polyclonal antibody

CBX5 polyclonal antibody