DERL1 polyclonal antibody
  • DERL1 polyclonal antibody

DERL1 polyclonal antibody

Ref: AB-PAB31482
DERL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DERL1.
Información adicional
Size 100 uL
Gene Name DERL1
Gene Alias DER-1|DER1|FLJ13784|FLJ42092|MGC3067|PRO2577
Gene Description Der1-like domain family, member 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 186-251 of human DERL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 79139
Iso type IgG

Enviar uma mensagem


DERL1 polyclonal antibody

DERL1 polyclonal antibody