PDE6A polyclonal antibody
  • PDE6A polyclonal antibody

PDE6A polyclonal antibody

Ref: AB-PAB31469
PDE6A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PDE6A.
Información adicional
Size 100 uL
Gene Name PDE6A
Gene Alias CGPR-A|PDEA
Gene Description phosphodiesterase 6A, cGMP-specific, rod, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDE6A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5145
Iso type IgG

Enviar uma mensagem


PDE6A polyclonal antibody

PDE6A polyclonal antibody