DEFA5 polyclonal antibody
  • DEFA5 polyclonal antibody

DEFA5 polyclonal antibody

Ref: AB-PAB31461
DEFA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DEFA5.
Información adicional
Size 100 uL
Gene Name DEFA5
Gene Alias DEF5|HD-5|MGC129728
Gene Description defensin, alpha 5, Paneth cell-specific
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DEFA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1670
Iso type IgG

Enviar uma mensagem


DEFA5 polyclonal antibody

DEFA5 polyclonal antibody