SCNN1B polyclonal antibody
  • SCNN1B polyclonal antibody

SCNN1B polyclonal antibody

Ref: AB-PAB31455
SCNN1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SCNN1B.
Información adicional
Size 100 uL
Gene Name SCNN1B
Gene Alias ENaCb|ENaCbeta|SCNEB
Gene Description sodium channel, nonvoltage-gated 1, beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SCNN1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6338
Iso type IgG

Enviar uma mensagem


SCNN1B polyclonal antibody

SCNN1B polyclonal antibody