CCBP2 polyclonal antibody
  • CCBP2 polyclonal antibody

CCBP2 polyclonal antibody

Ref: AB-PAB31440
CCBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CCBP2.
Información adicional
Size 100 uL
Gene Name CCBP2
Gene Alias CCR10|CCR9|CMKBR9|D6|MGC126678|MGC138250|hD6
Gene Description chemokine binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CCBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1238
Iso type IgG

Enviar uma mensagem


CCBP2 polyclonal antibody

CCBP2 polyclonal antibody