PTGER3 polyclonal antibody
  • PTGER3 polyclonal antibody

PTGER3 polyclonal antibody

Ref: AB-PAB31423
PTGER3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTGER3.
Información adicional
Size 100 uL
Gene Name PTGER3
Gene Alias EP3|EP3-I|EP3-II|EP3-III|EP3-IV|EP3e|MGC141828|MGC141829|MGC27302
Gene Description prostaglandin E receptor 3 (subtype EP3)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTGER3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5733
Iso type IgG

Enviar uma mensagem


PTGER3 polyclonal antibody

PTGER3 polyclonal antibody