COL6A3 polyclonal antibody
  • COL6A3 polyclonal antibody

COL6A3 polyclonal antibody

Ref: AB-PAB31418
COL6A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human COL6A3.
Información adicional
Size 100 uL
Gene Name COL6A3
Gene Alias DKFZp686D23123|DKFZp686K04147|DKFZp686N0262|FLJ34702|FLJ98399
Gene Description collagen, type VI, alpha 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human COL6A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1293
Iso type IgG

Enviar uma mensagem


COL6A3 polyclonal antibody

COL6A3 polyclonal antibody