ANXA6 polyclonal antibody
  • ANXA6 polyclonal antibody

ANXA6 polyclonal antibody

Ref: AB-PAB31417
ANXA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ANXA6.
Información adicional
Size 100 uL
Gene Name ANXA6
Gene Alias ANX6|CBP68
Gene Description annexin A6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ANXA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 309
Iso type IgG

Enviar uma mensagem


ANXA6 polyclonal antibody

ANXA6 polyclonal antibody