SIGLEC6 polyclonal antibody
  • SIGLEC6 polyclonal antibody

SIGLEC6 polyclonal antibody

Ref: AB-PAB31412
SIGLEC6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SIGLEC6.
Información adicional
Size 100 uL
Gene Name SIGLEC6
Gene Alias CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6
Gene Description sialic acid binding Ig-like lectin 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SIGLEC6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 946
Iso type IgG

Enviar uma mensagem


SIGLEC6 polyclonal antibody

SIGLEC6 polyclonal antibody