MST1R polyclonal antibody
  • MST1R polyclonal antibody

MST1R polyclonal antibody

Ref: AB-PAB31398
MST1R polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MST1R.
Información adicional
Size 100 uL
Gene Name MST1R
Gene Alias CD136|CDw136|PTK8|RON
Gene Description macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MST1R.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4486
Iso type IgG

Enviar uma mensagem


MST1R polyclonal antibody

MST1R polyclonal antibody