S100A4 polyclonal antibody
  • S100A4 polyclonal antibody

S100A4 polyclonal antibody

Ref: AB-PAB31397
S100A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human S100A4.
Información adicional
Size 100 uL
Gene Name S100A4
Gene Alias 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98
Gene Description S100 calcium binding protein A4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human S100A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6275
Iso type IgG

Enviar uma mensagem


S100A4 polyclonal antibody

S100A4 polyclonal antibody