COL3A1 polyclonal antibody
  • COL3A1 polyclonal antibody

COL3A1 polyclonal antibody

Ref: AB-PAB31390
COL3A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human COL3A1.
Información adicional
Size 100 uL
Gene Name COL3A1
Gene Alias EDS4A|FLJ34534
Gene Description collagen, type III, alpha 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human COL3A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1281
Iso type IgG

Enviar uma mensagem


COL3A1 polyclonal antibody

COL3A1 polyclonal antibody