ZMPSTE24 polyclonal antibody
  • ZMPSTE24 polyclonal antibody

ZMPSTE24 polyclonal antibody

Ref: AB-PAB31382
ZMPSTE24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ZMPSTE24.
Información adicional
Size 100 uL
Gene Name ZMPSTE24
Gene Alias FACE-1|FACE1|FLJ14968|STE24|Ste24p
Gene Description zinc metallopeptidase (STE24 homolog, S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZMPSTE24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10269
Iso type IgG

Enviar uma mensagem


ZMPSTE24 polyclonal antibody

ZMPSTE24 polyclonal antibody