ECH1 polyclonal antibody
  • ECH1 polyclonal antibody

ECH1 polyclonal antibody

Ref: AB-PAB31369
ECH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ECH1.
Información adicional
Size 100 uL
Gene Name ECH1
Gene Alias HPXEL
Gene Description enoyl Coenzyme A hydratase 1, peroxisomal
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ECH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1891
Iso type IgG

Enviar uma mensagem


ECH1 polyclonal antibody

ECH1 polyclonal antibody