TEC polyclonal antibody
  • TEC polyclonal antibody

TEC polyclonal antibody

Ref: AB-PAB31368
TEC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TEC.
Información adicional
Size 100 uL
Gene Name TEC
Gene Alias MGC126760|MGC126762|PSCTK4
Gene Description tec protein tyrosine kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TEC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7006
Iso type IgG

Enviar uma mensagem


TEC polyclonal antibody

TEC polyclonal antibody