ASAH1 polyclonal antibody
  • ASAH1 polyclonal antibody

ASAH1 polyclonal antibody

Ref: AB-PAB31359
ASAH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ASAH1.
Información adicional
Size 100 uL
Gene Name ASAH1
Gene Alias AC|ASAH|FLJ21558|FLJ22079|PHP|PHP32
Gene Description N-acylsphingosine amidohydrolase (acid ceramidase) 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ASAH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 427
Iso type IgG

Enviar uma mensagem


ASAH1 polyclonal antibody

ASAH1 polyclonal antibody