SLC2A5 polyclonal antibody
  • SLC2A5 polyclonal antibody

SLC2A5 polyclonal antibody

Ref: AB-PAB31357
SLC2A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLC2A5.
Información adicional
Size 100 uL
Gene Name SLC2A5
Gene Alias GLUT5
Gene Description solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC2A5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6518
Iso type IgG

Enviar uma mensagem


SLC2A5 polyclonal antibody

SLC2A5 polyclonal antibody