TULP4 polyclonal antibody
  • TULP4 polyclonal antibody

TULP4 polyclonal antibody

Ref: AB-PAB31356
TULP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TULP4.
Información adicional
Size 100 uL
Gene Name TULP4
Gene Alias KIAA1397|TUSP
Gene Description tubby like protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VLLHESDGVLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLAVAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TULP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 56995
Iso type IgG

Enviar uma mensagem


TULP4 polyclonal antibody

TULP4 polyclonal antibody