HTR1E polyclonal antibody
  • HTR1E polyclonal antibody

HTR1E polyclonal antibody

Ref: AB-PAB31352
HTR1E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HTR1E.
Información adicional
Size 100 uL
Gene Name HTR1E
Gene Alias 5-HT1E
Gene Description 5-hydroxytryptamine (serotonin) receptor 1E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HTR1E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3354
Iso type IgG

Enviar uma mensagem


HTR1E polyclonal antibody

HTR1E polyclonal antibody