GAS7 polyclonal antibody
  • GAS7 polyclonal antibody

GAS7 polyclonal antibody

Ref: AB-PAB31343
GAS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GAS7.
Información adicional
Size 100 uL
Gene Name GAS7
Gene Alias KIAA0394|MGC1348|MLL/GAS7
Gene Description growth arrest-specific 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GAS7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8522
Iso type IgG

Enviar uma mensagem


GAS7 polyclonal antibody

GAS7 polyclonal antibody