TNC polyclonal antibody
  • TNC polyclonal antibody

TNC polyclonal antibody

Ref: AB-PAB31294
TNC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNC.
Información adicional
Size 100 uL
Gene Name TNC
Gene Alias HXB|MGC167029|TN
Gene Description tenascin C
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1765-1898 of human TNC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3371
Iso type IgG

Enviar uma mensagem


TNC polyclonal antibody

TNC polyclonal antibody