ARHGEF7 polyclonal antibody
  • ARHGEF7 polyclonal antibody

ARHGEF7 polyclonal antibody

Ref: AB-PAB31289
ARHGEF7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARHGEF7.
Información adicional
Size 100 uL
Gene Name ARHGEF7
Gene Alias BETA-PIX|COOL1|DKFZp686C12170|DKFZp761K1021|KIAA0142|KIAA0412|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXB
Gene Description Rho guanine nucleotide exchange factor (GEF) 7
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 516-650 of human ARHGEF7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8874
Iso type IgG

Enviar uma mensagem


ARHGEF7 polyclonal antibody

ARHGEF7 polyclonal antibody